Web stats for Flammarion - flammarion.com
2.67 Rating by ClearWebStats
flammarion.com is 2 decades 4 years 2 months old. This website has a #465,926 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 6 out of 10. This domain is estimated value of $ 5,040.00 and has a daily earning of $ 14.00. While no active threats were reported recently by users, flammarion.com is SAFE to browse.
Traffic Report of Flammarion
Daily Unique Visitors: | 1,549 |
Daily Pageviews: | 4,647 |
Estimated Valuation
Income Per Day: | $ 14.00 |
Estimated Worth: | $ 5,040.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | 871 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Good |
WOT Privacy: | Good |
WOT Child Safety: | Excellent |
Website Ranks & Scores
Google Pagerank
PR 6 out of 10
PageSpeed Score
78
Siteadvisor Rating
Not Applicable
Where is flammarion.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 7 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 5 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 195.78.51.186)
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Server: Apache
ETag: "3f1abafc7ad2a6b7739bfb3e8d94a08b"
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: must-revalidate
Last-Modified: Tue, 28 Oct 2014 09:35:32 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Date: Wed, 29 Oct 2014 18:22:33 GMT
Connection: keep-alive
X-Geo: varn30.rbx5
X-Geo-Port: 1011
X-Cacheable: Cacheable
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Server: Apache
ETag: "3f1abafc7ad2a6b7739bfb3e8d94a08b"
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: must-revalidate
Last-Modified: Tue, 28 Oct 2014 09:35:32 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Date: Wed, 29 Oct 2014 18:22:33 GMT
Connection: keep-alive
X-Geo: varn30.rbx5
X-Geo-Port: 1011
X-Cacheable: Cacheable
Domain Information for flammarion.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
flammarion.com | A | 14603 |
IP:195.78.51.186 |
flammarion.com | NS | 21599 |
Target:ns2.emakina.be |
flammarion.com | NS | 21599 |
Target:ns1.emakina.be |
flammarion.com | SOA | 21599 |
MNAME:ns1.emakina.be.flammarion.com RNAME:dnsmaster.emakina.com Serial:2851241805 Refresh:28800 Retry:7200 Expire:604800 |
flammarion.com | MX | 16591 |
Priority:10 Target:mx.flammarion.com |
flammarion.com | TXT | 21599 |
TXT:Flammarion |
Similarly Ranked Websites to Flammarion
Dakku Daddy | We Grab Viral News
- dakkudaddy.in
Dakkudaddy is the whole new place to grab latest updates about anything and everything. If someone is peeing on the road side we will cover that too.
Communiquer gratuitement avec AutoPromoPro
- autopromopro.com
Communiquer gratuitement avec AutoPromoPro spécialiste de la diffusion de communiqué de presse depuis 2005
Happy Valentines Day Wallpaper & Images
- valentinesdaywallpaperimages.com
Happy Valentines Day Wallpaper & Images 2015 Coloring Pages Cliparts Clip arts Gift ideas best gift for him her lovely wife Husband Girlfriend boyfriend..